The Future of Personalized Medicine: Tailoring Treatments to Individual Needs Introduction Personalized medicine, also known as precision medicine, is an approach to healthc … read more 30th Jul 2024 Wiem Gasri
Understanding Cell Lines: A Technical Overview Cell lines are essential tools in biomedical research and biotechnology. They are widely used in dru … read more 20th Jun 2024 Wiem Gasri
Understanding Recombinant Antibodies: A Technical Overview Recombinant antibodies are engineered proteins used in diagnostics, therapeutics, and research. They … read more 20th Jun 2024 Wiem Gasri
Description Additional Information Description Olaparib, 500mg | GFG-6426 | Gentaur Distribution US, UK & Europe View AllClose Additional Information Size: 1 Kit View AllClose
Quick view Olaparib 250mg | GFG-6425 MSRP: Now: €168.00 Was: Olaparib 250mg | GFG-6425 | Gentaur Distribution US, UK & Europe
Quick view AZD2281 (Olaparib), 250 mg | GFG-0519 MSRP: Now: €500.00 Was: AZD2281 (Olaparib), 250 mg | GFG-0519 | Gentaur Distribution US, UK & Europe
Quick view Olaparib (AZD2281, Ku-0059436) - 10mg | GFG-6424 MSRP: Now: €340.00 Was: Olaparib (AZD2281, Ku-0059436) - 10mg | GFG-6424 | Gentaur Distribution US, UK & Europe
Quick view Venetoclax, Free Base - 500mg | GFG-9106 MSRP: Now: €348.00 Was: Venetoclax, Free Base - 500mg | GFG-9106 | Gentaur Distribution US, UK & Europe
Quick view Alpelisib, Free Base, 500mg | GFG-0720 MSRP: Now: €1,260.00 Was: Alpelisib, Free Base, 500mg | GFG-0720 | Gentaur Distribution US, UK & Europe
Quick view 4-Aminobutyric acid, Inhibitor, 500mg | GFG-0219 MSRP: Now: €625.00 Was: 4-Aminobutyric acid, Inhibitor, 500mg | GFG-0219 | Gentaur Distribution US, UK & Europe
Quick view hSmg-1 inhibitor 11j - 500mg | GFG-9521 MSRP: Now: €10,630.00 Was: hSmg-1 inhibitor 11j - 500mg | GFG-9521 | Gentaur Distribution US, UK & Europe
Quick view FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg | GFG-3065 MSRP: Now: €2,249.00 Was: FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg | GFG-3065 | Gentaur Distribution US, UK & Europe
Quick view Pronase E (Activity ≥ 7000 U/g) - 500mg | GFG-7110 MSRP: Now: €350.00 Was: Pronase E (Activity ≥ 7000 U/g) - 500mg | GFG-7110 | Gentaur Distribution US, UK & Europe