The Future of Personalized Medicine: Tailoring Treatments to Individual Needs Introduction Personalized medicine, also known as precision medicine, is an approach to healthc … read more 30th Jul 2024 Wiem Gasri
Understanding Cell Lines: A Technical Overview Cell lines are essential tools in biomedical research and biotechnology. They are widely used in dru … read more 20th Jun 2024 Wiem Gasri
Understanding Recombinant Antibodies: A Technical Overview Recombinant antibodies are engineered proteins used in diagnostics, therapeutics, and research. They … read more 20th Jun 2024 Wiem Gasri
Description Additional Information Description Pronase E (Activity ≥ 7000 U/g) - 500mg | GFG-7110 | Gentaur Distribution US, UK & Europe View AllClose Additional Information Size: 14 mL View AllClose
Quick view Pronase E (Activity ≥ 7000 U/g) - 100mg | GFG-7108 MSRP: Now: €259.00 Was: Pronase E (Activity ≥ 7000 U/g) - 100mg | GFG-7108 | Gentaur Distribution US, UK & Europe
Quick view Pronase E (Activity ≥ 7000 U/g) - 200mg | GFG-7109 MSRP: Now: €300.00 Was: Pronase E (Activity ≥ 7000 U/g) - 200mg | GFG-7109 | Gentaur Distribution US, UK & Europe
Quick view Olaparib, 500mg | GFG-6426 MSRP: Now: €298.00 Was: Olaparib, 500mg | GFG-6426 | Gentaur Distribution US, UK & Europe
Quick view Venetoclax, Free Base - 500mg | GFG-9106 MSRP: Now: €348.00 Was: Venetoclax, Free Base - 500mg | GFG-9106 | Gentaur Distribution US, UK & Europe
Quick view Alpelisib, Free Base, 500mg | GFG-0720 MSRP: Now: €1,260.00 Was: Alpelisib, Free Base, 500mg | GFG-0720 | Gentaur Distribution US, UK & Europe
Quick view Invertase - 600, 000 U/g - 1Kg | GFG-5098 MSRP: Now: €873.00 Was: Invertase - 600, 000 U/g - 1Kg | GFG-5098 | Gentaur Distribution US, UK & Europe
Quick view hSmg-1 inhibitor 11j - 500mg | GFG-9521 MSRP: Now: €10,630.00 Was: hSmg-1 inhibitor 11j - 500mg | GFG-9521 | Gentaur Distribution US, UK & Europe
Quick view 4-Aminobutyric acid, Inhibitor, 500mg | GFG-0219 MSRP: Now: €625.00 Was: 4-Aminobutyric acid, Inhibitor, 500mg | GFG-0219 | Gentaur Distribution US, UK & Europe
Quick view FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg | GFG-3065 MSRP: Now: €2,249.00 Was: FVNQHLSGSHLVEALYLVSGERGFFYTPKA Synthetic peptide, Purity: >98% - 500mg | GFG-3065 | Gentaur Distribution US, UK & Europe